Anti YKT6 pAb (ATL-HPA030817)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030817-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: YKT6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002741: 90%, ENSRNOG00000014785: 96%
Entrez Gene ID: 10652
Uniprot ID: O15498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ |
| Gene Sequence | LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ |
| Gene ID - Mouse | ENSMUSG00000002741 |
| Gene ID - Rat | ENSRNOG00000014785 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti YKT6 pAb (ATL-HPA030817) | |
| Datasheet | Anti YKT6 pAb (ATL-HPA030817) Datasheet (External Link) |
| Vendor Page | Anti YKT6 pAb (ATL-HPA030817) at Atlas Antibodies |
| Documents & Links for Anti YKT6 pAb (ATL-HPA030817) | |
| Datasheet | Anti YKT6 pAb (ATL-HPA030817) Datasheet (External Link) |
| Vendor Page | Anti YKT6 pAb (ATL-HPA030817) |
| Citations for Anti YKT6 pAb (ATL-HPA030817) – 1 Found |
| Xu, Dijin; Li, Yuqi; Wu, Lizhen; Li, Ying; Zhao, Dongyu; Yu, Jinhai; Huang, Tuozhi; Ferguson, Charles; Parton, Robert G; Yang, Hongyuan; Li, Peng. Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions. The Journal Of Cell Biology. 2018;217(3):975-995. PubMed |