Anti XRN1 pAb (ATL-HPA035006)

Atlas Antibodies

Catalog No.:
ATL-HPA035006-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: 5'-3' exoribonuclease 1
Gene Name: XRN1
Alternative Gene Name: SEP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032410: 84%, ENSRNOG00000042951: 85%
Entrez Gene ID: 54464
Uniprot ID: Q8IZH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRK
Gene Sequence NVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRK
Gene ID - Mouse ENSMUSG00000032410
Gene ID - Rat ENSRNOG00000042951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XRN1 pAb (ATL-HPA035006)
Datasheet Anti XRN1 pAb (ATL-HPA035006) Datasheet (External Link)
Vendor Page Anti XRN1 pAb (ATL-HPA035006) at Atlas Antibodies

Documents & Links for Anti XRN1 pAb (ATL-HPA035006)
Datasheet Anti XRN1 pAb (ATL-HPA035006) Datasheet (External Link)
Vendor Page Anti XRN1 pAb (ATL-HPA035006)