Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000527-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: XPNPEP3
Alternative Gene Name: APP3, NPHPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022401: 92%, ENSRNOG00000019196: 90%
Entrez Gene ID: 63929
Uniprot ID: Q9NQH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQ |
| Gene Sequence | THPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQ |
| Gene ID - Mouse | ENSMUSG00000022401 |
| Gene ID - Rat | ENSRNOG00000019196 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation) | |
| Datasheet | Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation) | |
| Datasheet | Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation) |
| Citations for Anti XPNPEP3 pAb (ATL-HPA000527 w/enhanced validation) – 2 Found |
| O'Toole, John F; Liu, Yangjian; Davis, Erica E; Westlake, Christopher J; Attanasio, Massimo; Otto, Edgar A; Seelow, Dominik; Nurnberg, Gudrun; Becker, Christian; Nuutinen, Matti; Kärppä, Mikko; Ignatius, Jaakko; Uusimaa, Johanna; Pakanen, Salla; Jaakkola, Elisa; van den Heuvel, Lambertus P; Fehrenbach, Henry; Wiggins, Roger; Goyal, Meera; Zhou, Weibin; Wolf, Matthias T F; Wise, Eric; Helou, Juliana; Allen, Susan J; Murga-Zamalloa, Carlos A; Ashraf, Shazia; Chaki, Moumita; Heeringa, Saskia; Chernin, Gil; Hoskins, Bethan E; Chaib, Hassan; Gleeson, Joseph; Kusakabe, Takehiro; Suzuki, Takako; Isaac, R Elwyn; Quarmby, Lynne M; Tennant, Bryan; Fujioka, Hisashi; Tuominen, Hannu; Hassinen, Ilmo; Lohi, Hellevi; van Houten, Judith L; Rotig, Agnes; Sayer, John A; Rolinski, Boris; Freisinger, Peter; Madhavan, Sethu M; Herzer, Martina; Madignier, Florence; Prokisch, Holger; Nurnberg, Peter; Jackson, Peter K; Khanna, Hemant; Katsanis, Nicholas; Hildebrandt, Friedhelm. Individuals with mutations in XPNPEP3, which encodes a mitochondrial protein, develop a nephronophthisis-like nephropathy. The Journal Of Clinical Investigation. 2010;120(3):791-802. PubMed |
| Kleffman, Kevin; Levinson, Grace; Rose, Indigo V L; Blumenberg, Lili M; Shadaloey, Sorin A A; Dhabaria, Avantika; Wong, Eitan; Galán-Echevarría, Francisco; Karz, Alcida; Argibay, Diana; Von Itter, Richard; Floristán, Alfredo; Baptiste, Gillian; Eskow, Nicole M; Tranos, James A; Chen, Jenny; Vega Y Saenz de Miera, Eleazar C; Call, Melissa; Rogers, Robert; Jour, George; Wadghiri, Youssef Zaim; Osman, Iman; Li, Yue-Ming; Mathews, Paul; DeMattos, Ronald B; Ueberheide, Beatrix; Ruggles, Kelly V; Liddelow, Shane A; Schneider, Robert J; Hernando, Eva. Melanoma-Secreted Amyloid Beta Suppresses Neuroinflammation and Promotes Brain Metastasis. Cancer Discovery. 2022;12(5):1314-1335. PubMed |