Anti XKR9 pAb (ATL-HPA044430)

Atlas Antibodies

Catalog No.: ATL-HPA044430-25

Protein Description: XK, Kell blood group complex subunit-related family, member 9
Gene Name: XKR9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067813: 61%, ENSRNOG00000040289: 58%
Entrez Gene ID: 389668
Uniprot ID: Q5GH70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHPNRSAETKCDEIDGKPVLRECRMRYFLME
• Gene Sequence: FHPNRSAETKCDEIDGKPVLRECRMRYFLME
• Gene ID - Mouse: ENSMUSG00000067813
• Gene ID - Rat: ENSRNOG00000040289
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.