Anti WWC3 pAb (ATL-HPA039814)

Atlas Antibodies

Catalog No.:
ATL-HPA039814-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WWC family member 3
Gene Name: WWC3
Alternative Gene Name: BM042, KIAA1280
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031563: 31%, ENSRNOG00000024250: 82%
Entrez Gene ID: 55841
Uniprot ID: Q9ULE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGT
Gene Sequence KRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGT
Gene ID - Mouse ENSMUSG00000031563
Gene ID - Rat ENSRNOG00000024250
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WWC3 pAb (ATL-HPA039814)
Datasheet Anti WWC3 pAb (ATL-HPA039814) Datasheet (External Link)
Vendor Page Anti WWC3 pAb (ATL-HPA039814) at Atlas Antibodies

Documents & Links for Anti WWC3 pAb (ATL-HPA039814)
Datasheet Anti WWC3 pAb (ATL-HPA039814) Datasheet (External Link)
Vendor Page Anti WWC3 pAb (ATL-HPA039814)
Citations for Anti WWC3 pAb (ATL-HPA039814) – 4 Found
Chen, Beijia; Liu, Guinan. WWC3 inhibits intimal proliferation following vascular injury via the Hippo signaling pathway. Molecular Medicine Reports. 2018;17(4):5175-5183.  PubMed
Han, Qiang; Kremerskothen, Joachim; Lin, Xuyong; Zhang, Xiupeng; Rong, Xuezhu; Zhang, Di; Wang, Enhua. WWC3 inhibits epithelial-mesenchymal transition of lung cancer by activating Hippo-YAP signaling. Oncotargets And Therapy. 11( 29780251):2581-2591.  PubMed
Han, Qiang; Rong, Xuezhu; Wang, Enhua; Liu, Shuli. WW and C2 domain-containing protein-3 promoted EBSS-induced apoptosis through inhibiting autophagy in non-small cell lung cancer cells. Journal Of Thoracic Disease. 2020;12(8):4205-4215.  PubMed
Yamato, Azusa; Nagano, Hidekazu; Gao, Yue; Matsuda, Tatsuma; Hashimoto, Naoko; Nakayama, Akitoshi; Yamagata, Kazuyuki; Yokoyama, Masataka; Gong, Yingbo; Shi, Xiaoyan; Zhahara, Siti Nurul; Kono, Takashi; Taki, Yuki; Furuki, Naoto; Nishimura, Motoi; Horiguchi, Kentaro; Iwadate, Yasuo; Fukuyo, Masaki; Rahmutulla, Bahityar; Kaneda, Atsushi; Hasegawa, Yoshinori; Kawashima, Yusuke; Ohara, Osamu; Ishikawa, Tetsuo; Kawakami, Eiryo; Nakamura, Yasuhiro; Inoshita, Naoko; Yamada, Shozo; Fukuhara, Noriaki; Nishioka, Hiroshi; Tanaka, Tomoaki. Proteogenomic landscape and clinical characterization of GH-producing pituitary adenomas/somatotroph pituitary neuroendocrine tumors. Communications Biology. 2022;5(1):1304.  PubMed