Anti WWC3 pAb (ATL-HPA039814)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039814-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: WWC3
Alternative Gene Name: BM042, KIAA1280
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031563: 31%, ENSRNOG00000024250: 82%
Entrez Gene ID: 55841
Uniprot ID: Q9ULE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGT |
| Gene Sequence | KRLERRARRISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGT |
| Gene ID - Mouse | ENSMUSG00000031563 |
| Gene ID - Rat | ENSRNOG00000024250 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WWC3 pAb (ATL-HPA039814) | |
| Datasheet | Anti WWC3 pAb (ATL-HPA039814) Datasheet (External Link) |
| Vendor Page | Anti WWC3 pAb (ATL-HPA039814) at Atlas Antibodies |
| Documents & Links for Anti WWC3 pAb (ATL-HPA039814) | |
| Datasheet | Anti WWC3 pAb (ATL-HPA039814) Datasheet (External Link) |
| Vendor Page | Anti WWC3 pAb (ATL-HPA039814) |
| Citations for Anti WWC3 pAb (ATL-HPA039814) – 4 Found |
| Chen, Beijia; Liu, Guinan. WWC3 inhibits intimal proliferation following vascular injury via the Hippo signaling pathway. Molecular Medicine Reports. 2018;17(4):5175-5183. PubMed |
| Han, Qiang; Kremerskothen, Joachim; Lin, Xuyong; Zhang, Xiupeng; Rong, Xuezhu; Zhang, Di; Wang, Enhua. WWC3 inhibits epithelial-mesenchymal transition of lung cancer by activating Hippo-YAP signaling. Oncotargets And Therapy. 11( 29780251):2581-2591. PubMed |
| Han, Qiang; Rong, Xuezhu; Wang, Enhua; Liu, Shuli. WW and C2 domain-containing protein-3 promoted EBSS-induced apoptosis through inhibiting autophagy in non-small cell lung cancer cells. Journal Of Thoracic Disease. 2020;12(8):4205-4215. PubMed |
| Yamato, Azusa; Nagano, Hidekazu; Gao, Yue; Matsuda, Tatsuma; Hashimoto, Naoko; Nakayama, Akitoshi; Yamagata, Kazuyuki; Yokoyama, Masataka; Gong, Yingbo; Shi, Xiaoyan; Zhahara, Siti Nurul; Kono, Takashi; Taki, Yuki; Furuki, Naoto; Nishimura, Motoi; Horiguchi, Kentaro; Iwadate, Yasuo; Fukuyo, Masaki; Rahmutulla, Bahityar; Kaneda, Atsushi; Hasegawa, Yoshinori; Kawashima, Yusuke; Ohara, Osamu; Ishikawa, Tetsuo; Kawakami, Eiryo; Nakamura, Yasuhiro; Inoshita, Naoko; Yamada, Shozo; Fukuhara, Noriaki; Nishioka, Hiroshi; Tanaka, Tomoaki. Proteogenomic landscape and clinical characterization of GH-producing pituitary adenomas/somatotroph pituitary neuroendocrine tumors. Communications Biology. 2022;5(1):1304. PubMed |