Anti WWC2 pAb (ATL-HPA044005)

Atlas Antibodies

Catalog No.: ATL-HPA044005-25

Protein Description: WW and C2 domain containing 2
Gene Name: WWC2
Alternative Gene Name: BOMB, FLJ22029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031563: 82%, ENSRNOG00000013248: 80%
Entrez Gene ID: 80014
Uniprot ID: Q6AWC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDSVFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESG
• Gene Sequence: LRVDLCSVSKHRREECLAGTQISLADLPFSSEVFTLWYNLLPSKQMPCKKNEENEDSVFQPNQPLVDSIDLDAVSALLARTSAELLAVEQELAQEEEEESG
• Gene ID - Mouse: ENSMUSG00000031563
• Gene ID - Rat: ENSRNOG00000013248
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WWC2 pAb (ATL-HPA044005) – 1 Found

Mendoza, Matthew L; Quigley, Lilyana D; Dunham, Thomas; Volk, Lenora J. KIBRA regulates activity-induced AMPA receptor expression and synaptic plasticity in an age-dependent manner. Iscience. 2022;25(12):105623.