Anti WRAP53 pAb (ATL-HPA029928)

Atlas Antibodies

Catalog No.: ATL-HPA029928-25

Protein Description: WD repeat containing, antisense to TP53
Gene Name: WRAP53
Alternative Gene Name: FLJ10385, TCAB1, WDR79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041346: 53%, ENSRNOG00000010520: 55%
Entrez Gene ID: 55135
Uniprot ID: Q9BUR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT
• Gene Sequence: MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT
• Gene ID - Mouse: ENSMUSG00000041346
• Gene ID - Rat: ENSRNOG00000010520
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.