Anti WNK2 pAb (ATL-HPA016519 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA016519-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: WNK lysine deficient protein kinase 2
Gene Name: WNK2
Alternative Gene Name: KIAA1760, NY-CO-43, PRKWNK2, SDCCAG43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037989: 60%, ENSRNOG00000016684: 59%
Entrez Gene ID: 65268
Uniprot ID: Q9Y3S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLR
Gene Sequence GTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSVPQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDMGTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAKTVGRFSVVSTQDEWTLASPHSLR
Gene ID - Mouse ENSMUSG00000037989
Gene ID - Rat ENSRNOG00000016684
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WNK2 pAb (ATL-HPA016519 w/enhanced validation)
Datasheet Anti WNK2 pAb (ATL-HPA016519 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WNK2 pAb (ATL-HPA016519 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti WNK2 pAb (ATL-HPA016519 w/enhanced validation)
Datasheet Anti WNK2 pAb (ATL-HPA016519 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WNK2 pAb (ATL-HPA016519 w/enhanced validation)