Anti WIPF3 pAb (ATL-HPA041211)

Atlas Antibodies

Catalog No.: ATL-HPA041211-25

Protein Description: WAS/WASL interacting protein family, member 3
Gene Name: WIPF3
Alternative Gene Name: CR16, FLJ36931
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086040: 78%, ENSRNOG00000009571: 77%
Entrez Gene ID: 644150
Uniprot ID: A6NGB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFESKFTFHSVEDFPPPDEYKPCQKIYPS
• Gene Sequence: ELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFESKFTFHSVEDFPPPDEYKPCQKIYPS
• Gene ID - Mouse: ENSMUSG00000086040
• Gene ID - Rat: ENSRNOG00000009571
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WIPF3 pAb (ATL-HPA041211) – 1 Found

Maeda, Yuko; Sato, Noriko; Naka-Mieno, Makiko; Mori, Seijiro; Arai, Tomio; Tanaka, Masashi; Muramatsu, Masaaki; Sawabe, Motoji. Association of non-synonymous variants in WIPF3 and LIPA genes with abdominal aortic aneurysm: an autopsy study. Journal Of Geriatric Cardiology : Jgc. 2016;13(12):960-967.