Anti WIPF3 pAb (ATL-HPA041145)

Atlas Antibodies

Catalog No.: ATL-HPA041145-25

Protein Description: WAS/WASL interacting protein family, member 3
Gene Name: WIPF3
Alternative Gene Name: CR16, FLJ36931
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000086040: 80%, ENSRNOG00000009571: 85%
Entrez Gene ID: 644150
Uniprot ID: A6NGB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
• Gene Sequence: QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
• Gene ID - Mouse: ENSMUSG00000086040
• Gene ID - Rat: ENSRNOG00000009571
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WIPF3 pAb (ATL-HPA041145) – 1 Found

De Luca, Francesco; Kha, Michelle; Swärd, Karl; Johansson, Martin E. Identification of ARMH4 and WIPF3 as human podocyte proteins with potential roles in immunomodulation and cytoskeletal dynamics. Plos One. 18(1):e0280270.