Anti WFIKKN1 pAb (ATL-HPA044237)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044237-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WFIKKN1
Alternative Gene Name: C16orf12, RJD2, WFDC20A, WFIKKN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071192: 84%, ENSRNOG00000021578: 82%
Entrez Gene ID: 117166
Uniprot ID: Q96NZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | STCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDI |
| Gene Sequence | STCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDI |
| Gene ID - Mouse | ENSMUSG00000071192 |
| Gene ID - Rat | ENSRNOG00000021578 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WFIKKN1 pAb (ATL-HPA044237) | |
| Datasheet | Anti WFIKKN1 pAb (ATL-HPA044237) Datasheet (External Link) |
| Vendor Page | Anti WFIKKN1 pAb (ATL-HPA044237) at Atlas Antibodies |
| Documents & Links for Anti WFIKKN1 pAb (ATL-HPA044237) | |
| Datasheet | Anti WFIKKN1 pAb (ATL-HPA044237) Datasheet (External Link) |
| Vendor Page | Anti WFIKKN1 pAb (ATL-HPA044237) |