Anti WFIKKN1 pAb (ATL-HPA044237)

Atlas Antibodies

Catalog No.: ATL-HPA044237-25

Protein Description: WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1
Gene Name: WFIKKN1
Alternative Gene Name: C16orf12, RJD2, WFDC20A, WFIKKN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071192: 84%, ENSRNOG00000021578: 82%
Entrez Gene ID: 117166
Uniprot ID: Q96NZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDI
• Gene Sequence: STCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDI
• Gene ID - Mouse: ENSMUSG00000071192
• Gene ID - Rat: ENSRNOG00000021578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.