Anti WFDC1 pAb (ATL-HPA031411)

Atlas Antibodies

Catalog No.:
ATL-HPA031411-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WAP four-disulfide core domain 1
Gene Name: WFDC1
Alternative Gene Name: PS20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023336: 82%, ENSRNOG00000015904: 81%
Entrez Gene ID: 58189
Uniprot ID: Q9HC57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
Gene Sequence LLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
Gene ID - Mouse ENSMUSG00000023336
Gene ID - Rat ENSRNOG00000015904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WFDC1 pAb (ATL-HPA031411)
Datasheet Anti WFDC1 pAb (ATL-HPA031411) Datasheet (External Link)
Vendor Page Anti WFDC1 pAb (ATL-HPA031411) at Atlas Antibodies

Documents & Links for Anti WFDC1 pAb (ATL-HPA031411)
Datasheet Anti WFDC1 pAb (ATL-HPA031411) Datasheet (External Link)
Vendor Page Anti WFDC1 pAb (ATL-HPA031411)
Citations for Anti WFDC1 pAb (ATL-HPA031411) – 2 Found
Zhao, Linjie; Wang, Wei; Huang, Shuang; Yang, Zhengnan; Xu, Lian; Yang, Qilian; Zhou, Xiu; Wang, Jinjin; Shen, Qiuhong; Wang, Chenlu; Le, Xiaobing; Feng, Min; Zhou, Nianxin; Lau, Wayne Bond; Lau, Bonnie; Yao, Shaohua; Yi, Tao; Wang, Xin; Zhao, Xia; Wei, Yuquan; Zhou, Shengtao. The RNA binding protein SORBS2 suppresses metastatic colonization of ovarian cancer by stabilizing tumor-suppressive immunomodulatory transcripts. Genome Biology. 2018;19(1):35.  PubMed
Wilson, Brian J; Saab, Karim R; Ma, Jie; Schatton, Tobias; Pütz, Pablo; Zhan, Qian; Murphy, George F; Gasser, Martin; Waaga-Gasser, Ana Maria; Frank, Natasha Y; Frank, Markus H. ABCB5 maintains melanoma-initiating cells through a proinflammatory cytokine signaling circuit. Cancer Research. 2014;74(15):4196-207.  PubMed