Anti WDYHV1 pAb (ATL-HPA024823)

Atlas Antibodies

Catalog No.: ATL-HPA024823-25

Protein Description: WDYHV motif containing 1
Gene Name: WDYHV1
Alternative Gene Name: C8orf32, FLJ10204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022359: 91%, ENSRNOG00000006700: 94%
Entrez Gene ID: 55093
Uniprot ID: Q96HA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSK
• Gene Sequence: YLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSK
• Gene ID - Mouse: ENSMUSG00000022359
• Gene ID - Rat: ENSRNOG00000006700
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.