Anti WDR73 pAb (ATL-HPA039357 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039357-25

Protein Description: WD repeat domain 73
Gene Name: WDR73
Alternative Gene Name: FLJ14888, HSPC264
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025722: 73%, ENSRNOG00000010664: 71%
Entrez Gene ID: 84942
Uniprot ID: Q6P4I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDW
• Gene Sequence: ISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDW
• Gene ID - Mouse: ENSMUSG00000025722
• Gene ID - Rat: ENSRNOG00000010664
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR73 pAb (ATL-HPA039357 w/enhanced validation) – 2 Found

Jinks, Robert N; Puffenberger, Erik G; Baple, Emma; Harding, Brian; Crino, Peter; Fogo, Agnes B; Wenger, Olivia; Xin, Baozhong; Koehler, Alanna E; McGlincy, Madeleine H; Provencher, Margaret M; Smith, Jeffrey D; Tran, Linh; Al Turki, Saeed; Chioza, Barry A; Cross, Harold; Harlalka, Gaurav V; Hurles, Matthew E; Maroofian, Reza; Heaps, Adam D; Morton, Mary C; Stempak, Lisa; Hildebrandt, Friedhelm; Sadowski, Carolin E; Zaritsky, Joshua; Campellone, Kenneth; Morton, D Holmes; Wang, Heng; Crosby, Andrew; Strauss, Kevin A. Recessive nephrocerebellar syndrome on the Galloway-Mowat syndrome spectrum is caused by homozygous protein-truncating mutations of WDR73. Brain : A Journal Of Neurology. 2015;138(Pt 8):2173-90. 

Tilley, F C; Arrondel, C; Chhuon, C; Boisson, M; Cagnard, N; Parisot, M; Menara, G; Lefort, N; Guerrera, I C; Bole-Feysot, C; Benmerah, A; Antignac, C; Mollet, G. Disruption of pathways regulated by Integrator complex in Galloway-Mowat syndrome due to WDR73 mutations. Scientific Reports. 2021;11(1):5388.