Anti WDR66 pAb (ATL-HPA040005 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040005-25

Protein Description: WD repeat domain 66
Gene Name: WDR66
Alternative Gene Name: CaM-IP4, MGC33630
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029442: 92%, ENSRNOG00000001342: 91%
Entrez Gene ID: 144406
Uniprot ID: Q8TBY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REGKFYRELEDYFYYSQLRSQGIDTMETRKVSEHICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPFGNTMSGI
• Gene Sequence: REGKFYRELEDYFYYSQLRSQGIDTMETRKVSEHICLSELPFVMRAIGFYPSEEKIDDIFNEIKFGEYVDTGKLIDKINLPDFLKVYLNHKPPFGNTMSGI
• Gene ID - Mouse: ENSMUSG00000029442
• Gene ID - Rat: ENSRNOG00000001342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WDR66 pAb (ATL-HPA040005 w/enhanced validation) – 1 Found

Auguste, Yasmina; Delague, Valérie; Desvignes, Jean-Pierre; Longepied, Guy; Gnisci, Audrey; Besnier, Pierre; Levy, Nicolas; Beroud, Christophe; Megarbane, André; Metzler-Guillemain, Catherine; Mitchell, Michael J. Loss of Calmodulin- and Radial-Spoke-Associated Complex Protein CFAP251 Leads to Immotile Spermatozoa Lacking Mitochondria and Infertility in Men. American Journal Of Human Genetics. 2018;103(3):413-420.