Anti WDR47 pAb (ATL-HPA027289)

Atlas Antibodies

Catalog No.:
ATL-HPA027289-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 47
Gene Name: WDR47
Alternative Gene Name: KIAA0893
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040389: 85%, ENSRNOG00000020330: 85%
Entrez Gene ID: 22911
Uniprot ID: O94967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYPDVIDPSAHETPKQPVV
Gene Sequence EHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYPDVIDPSAHETPKQPVV
Gene ID - Mouse ENSMUSG00000040389
Gene ID - Rat ENSRNOG00000020330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR47 pAb (ATL-HPA027289)
Datasheet Anti WDR47 pAb (ATL-HPA027289) Datasheet (External Link)
Vendor Page Anti WDR47 pAb (ATL-HPA027289) at Atlas Antibodies

Documents & Links for Anti WDR47 pAb (ATL-HPA027289)
Datasheet Anti WDR47 pAb (ATL-HPA027289) Datasheet (External Link)
Vendor Page Anti WDR47 pAb (ATL-HPA027289)