Anti WDR47 pAb (ATL-HPA027289)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027289-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WDR47
Alternative Gene Name: KIAA0893
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040389: 85%, ENSRNOG00000020330: 85%
Entrez Gene ID: 22911
Uniprot ID: O94967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYPDVIDPSAHETPKQPVV |
| Gene Sequence | EHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYPDVIDPSAHETPKQPVV |
| Gene ID - Mouse | ENSMUSG00000040389 |
| Gene ID - Rat | ENSRNOG00000020330 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WDR47 pAb (ATL-HPA027289) | |
| Datasheet | Anti WDR47 pAb (ATL-HPA027289) Datasheet (External Link) |
| Vendor Page | Anti WDR47 pAb (ATL-HPA027289) at Atlas Antibodies |
| Documents & Links for Anti WDR47 pAb (ATL-HPA027289) | |
| Datasheet | Anti WDR47 pAb (ATL-HPA027289) Datasheet (External Link) |
| Vendor Page | Anti WDR47 pAb (ATL-HPA027289) |