Anti WDR47 pAb (ATL-HPA027287)

Atlas Antibodies

Catalog No.: ATL-HPA027287-25

Protein Description: WD repeat domain 47
Gene Name: WDR47
Alternative Gene Name: KIAA0893
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040389: 100%, ENSRNOG00000020330: 100%
Entrez Gene ID: 22911
Uniprot ID: O94967
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYP
• Gene Sequence: LLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYP
• Gene ID - Mouse: ENSMUSG00000040389
• Gene ID - Rat: ENSRNOG00000020330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.