Anti WDR34 pAb (ATL-HPA041091)

Atlas Antibodies

Catalog No.:
ATL-HPA041091-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 34
Gene Name: WDR34
Alternative Gene Name: bA216B9.3, DIC5, FAP133, MGC20486
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039715: 84%, ENSRNOG00000015636: 83%
Entrez Gene ID: 89891
Uniprot ID: Q96EX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLR
Gene Sequence LRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLR
Gene ID - Mouse ENSMUSG00000039715
Gene ID - Rat ENSRNOG00000015636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR34 pAb (ATL-HPA041091)
Datasheet Anti WDR34 pAb (ATL-HPA041091) Datasheet (External Link)
Vendor Page Anti WDR34 pAb (ATL-HPA041091) at Atlas Antibodies

Documents & Links for Anti WDR34 pAb (ATL-HPA041091)
Datasheet Anti WDR34 pAb (ATL-HPA041091) Datasheet (External Link)
Vendor Page Anti WDR34 pAb (ATL-HPA041091)
Citations for Anti WDR34 pAb (ATL-HPA041091) – 2 Found
Taylor, S Paige; Dantas, Tiago J; Duran, Ivan; Wu, Sulin; Lachman, Ralph S; Nelson, Stanley F; Cohn, Daniel H; Vallee, Richard B; Krakow, Deborah. Mutations in DYNC2LI1 disrupt cilia function and cause short rib polydactyly syndrome. Nature Communications. 2015;6( 26077881):7092.  PubMed
Bosakova, Michaela; Abraham, Sara P; Nita, Alexandru; Hruba, Eva; Buchtova, Marcela; Taylor, S Paige; Duran, Ivan; Martin, Jorge; Svozilova, Katerina; Barta, Tomas; Varecha, Miroslav; Balek, Lukas; Kohoutek, Jiri; Radaszkiewicz, Tomasz; Pusapati, Ganesh V; Bryja, Vitezslav; Rush, Eric T; Thiffault, Isabelle; Nickerson, Deborah A; Bamshad, Michael J; Rohatgi, Rajat; Cohn, Daniel H; Krakow, Deborah; Krejci, Pavel. Mutations in GRK2 cause Jeune syndrome by impairing Hedgehog and canonical Wnt signaling. Embo Molecular Medicine. 2020;12(11):e11739.  PubMed