Anti WDR34 pAb (ATL-HPA041091)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041091-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WDR34
Alternative Gene Name: bA216B9.3, DIC5, FAP133, MGC20486
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039715: 84%, ENSRNOG00000015636: 83%
Entrez Gene ID: 89891
Uniprot ID: Q96EX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLR |
| Gene Sequence | LRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLR |
| Gene ID - Mouse | ENSMUSG00000039715 |
| Gene ID - Rat | ENSRNOG00000015636 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WDR34 pAb (ATL-HPA041091) | |
| Datasheet | Anti WDR34 pAb (ATL-HPA041091) Datasheet (External Link) |
| Vendor Page | Anti WDR34 pAb (ATL-HPA041091) at Atlas Antibodies |
| Documents & Links for Anti WDR34 pAb (ATL-HPA041091) | |
| Datasheet | Anti WDR34 pAb (ATL-HPA041091) Datasheet (External Link) |
| Vendor Page | Anti WDR34 pAb (ATL-HPA041091) |
| Citations for Anti WDR34 pAb (ATL-HPA041091) – 2 Found |
| Taylor, S Paige; Dantas, Tiago J; Duran, Ivan; Wu, Sulin; Lachman, Ralph S; Nelson, Stanley F; Cohn, Daniel H; Vallee, Richard B; Krakow, Deborah. Mutations in DYNC2LI1 disrupt cilia function and cause short rib polydactyly syndrome. Nature Communications. 2015;6( 26077881):7092. PubMed |
| Bosakova, Michaela; Abraham, Sara P; Nita, Alexandru; Hruba, Eva; Buchtova, Marcela; Taylor, S Paige; Duran, Ivan; Martin, Jorge; Svozilova, Katerina; Barta, Tomas; Varecha, Miroslav; Balek, Lukas; Kohoutek, Jiri; Radaszkiewicz, Tomasz; Pusapati, Ganesh V; Bryja, Vitezslav; Rush, Eric T; Thiffault, Isabelle; Nickerson, Deborah A; Bamshad, Michael J; Rohatgi, Rajat; Cohn, Daniel H; Krakow, Deborah; Krejci, Pavel. Mutations in GRK2 cause Jeune syndrome by impairing Hedgehog and canonical Wnt signaling. Embo Molecular Medicine. 2020;12(11):e11739. PubMed |