Anti WDR19 pAb (ATL-HPA039616)

Atlas Antibodies

Catalog No.:
ATL-HPA039616-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: WD repeat domain 19
Gene Name: WDR19
Alternative Gene Name: DYF-2, FLJ23127, IFT144, KIAA1638, NPHP13, ORF26, Oseg6, Pwdmp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037890: 94%, ENSRNOG00000002932: 93%
Entrez Gene ID: 57728
Uniprot ID: Q8NEZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKG
Gene Sequence TGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKG
Gene ID - Mouse ENSMUSG00000037890
Gene ID - Rat ENSRNOG00000002932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WDR19 pAb (ATL-HPA039616)
Datasheet Anti WDR19 pAb (ATL-HPA039616) Datasheet (External Link)
Vendor Page Anti WDR19 pAb (ATL-HPA039616) at Atlas Antibodies

Documents & Links for Anti WDR19 pAb (ATL-HPA039616)
Datasheet Anti WDR19 pAb (ATL-HPA039616) Datasheet (External Link)
Vendor Page Anti WDR19 pAb (ATL-HPA039616)