Anti WDFY4 pAb (ATL-HPA040634)

Atlas Antibodies

Catalog No.: ATL-HPA040634-25

Protein Description: WDFY family member 4
Gene Name: WDFY4
Alternative Gene Name: C10orf64, Em:AC060234.3, FLJ45748, KIAA1607
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051506: 81%, ENSRNOG00000029662: 77%
Entrez Gene ID: 57705
Uniprot ID: Q6ZS81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM
• Gene Sequence: VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM
• Gene ID - Mouse: ENSMUSG00000051506
• Gene ID - Rat: ENSRNOG00000029662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.