Anti WBP4 pAb (ATL-HPA038965)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038965-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: WBP4
Alternative Gene Name: FBP21, MGC117310
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022023: 87%, ENSRNOG00000011678: 88%
Entrez Gene ID: 11193
Uniprot ID: O75554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEK |
| Gene Sequence | YCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEK |
| Gene ID - Mouse | ENSMUSG00000022023 |
| Gene ID - Rat | ENSRNOG00000011678 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WBP4 pAb (ATL-HPA038965) | |
| Datasheet | Anti WBP4 pAb (ATL-HPA038965) Datasheet (External Link) |
| Vendor Page | Anti WBP4 pAb (ATL-HPA038965) at Atlas Antibodies |
| Documents & Links for Anti WBP4 pAb (ATL-HPA038965) | |
| Datasheet | Anti WBP4 pAb (ATL-HPA038965) Datasheet (External Link) |
| Vendor Page | Anti WBP4 pAb (ATL-HPA038965) |