Anti VWCE pAb (ATL-HPA043921)

Atlas Antibodies

Catalog No.:
ATL-HPA043921-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: von Willebrand factor C and EGF domains
Gene Name: VWCE
Alternative Gene Name: FLJ32009, URG11, VWC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043789: 93%, ENSRNOG00000060269: 93%
Entrez Gene ID: 220001
Uniprot ID: Q96DN2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGDECTTCVCQNGEVECSFMPCPELACPREEWRLGPGQCCFTCQEPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSVSCKRTDCVDSCP
Gene Sequence GGDECTTCVCQNGEVECSFMPCPELACPREEWRLGPGQCCFTCQEPTPSTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSVSCKRTDCVDSCP
Gene ID - Mouse ENSMUSG00000043789
Gene ID - Rat ENSRNOG00000060269
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VWCE pAb (ATL-HPA043921)
Datasheet Anti VWCE pAb (ATL-HPA043921) Datasheet (External Link)
Vendor Page Anti VWCE pAb (ATL-HPA043921) at Atlas Antibodies

Documents & Links for Anti VWCE pAb (ATL-HPA043921)
Datasheet Anti VWCE pAb (ATL-HPA043921) Datasheet (External Link)
Vendor Page Anti VWCE pAb (ATL-HPA043921)