Anti VWA5A pAb (ATL-HPA037814)

Atlas Antibodies

Catalog No.: ATL-HPA037814-25

Protein Description: von Willebrand factor A domain containing 5A
Gene Name: VWA5A
Alternative Gene Name: BCSC-1, LOH11CR2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023186: 69%, ENSRNOG00000000195: 69%
Entrez Gene ID: 4013
Uniprot ID: O00534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLSWHLPPGLSAKMLSPEQTVIFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMGLRETPASDK
• Gene Sequence: SLSWHLPPGLSAKMLSPEQTVIFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMGLRETPASDK
• Gene ID - Mouse: ENSMUSG00000023186
• Gene ID - Rat: ENSRNOG00000000195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.