Anti VWA3B pAb (ATL-HPA036700)

Atlas Antibodies

Catalog No.: ATL-HPA036700-25

Protein Description: von Willebrand factor A domain containing 3B
Gene Name: VWA3B
Alternative Gene Name: DKFZp686F2227, MGC26733
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050122: 58%, ENSRNOG00000007927: 25%
Entrez Gene ID: 200403
Uniprot ID: Q502W6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKP
• Gene Sequence: LTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKP
• Gene ID - Mouse: ENSMUSG00000050122
• Gene ID - Rat: ENSRNOG00000007927
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.