Anti VTI1B pAb (ATL-HPA044121)

Atlas Antibodies

Catalog No.: ATL-HPA044121-25

Protein Description: vesicle transport through interaction with t-SNAREs 1B
Gene Name: VTI1B
Alternative Gene Name: VTI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021124: 96%, ENSRNOG00000060436: 96%
Entrez Gene ID: 10490
Uniprot ID: Q9UEU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGR
• Gene Sequence: ASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGR
• Gene ID - Mouse: ENSMUSG00000021124
• Gene ID - Rat: ENSRNOG00000060436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.