Anti VSTM2L pAb (ATL-HPA043832 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043832-100

Protein Description: V-set and transmembrane domain containing 2 like
Gene Name: VSTM2L
Alternative Gene Name: C20orf102, dJ1118M15.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037843: 94%, ENSRNOG00000034031: 94%
Entrez Gene ID: 128434
Uniprot ID: Q96N03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYEC
• Gene Sequence: QWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYEC
• Gene ID - Mouse: ENSMUSG00000037843
• Gene ID - Rat: ENSRNOG00000034031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.