Anti VPS9D1 pAb (ATL-HPA023620)

Atlas Antibodies

Catalog No.: ATL-HPA023620-25

Protein Description: VPS9 domain containing 1
Gene Name: VPS9D1
Alternative Gene Name: ATP-BL, C16orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001062: 86%, ENSRNOG00000028904: 85%
Entrez Gene ID: 9605
Uniprot ID: Q9Y2B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAKAREETLQRKMEERRLRLQEAANRRFCSQVALTPEEREQRALYAAILEYEQDHDWPKHWKAKLKRNPGDLSLVTSLVSHLLSLPDHPIAQLLRRLQCSVYSALYPAVSRAAAPAPGCCPPTPNPGSR
• Gene Sequence: IAKAREETLQRKMEERRLRLQEAANRRFCSQVALTPEEREQRALYAAILEYEQDHDWPKHWKAKLKRNPGDLSLVTSLVSHLLSLPDHPIAQLLRRLQCSVYSALYPAVSRAAAPAPGCCPPTPNPGSR
• Gene ID - Mouse: ENSMUSG00000001062
• Gene ID - Rat: ENSRNOG00000028904
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.