Anti VPS9D1 pAb (ATL-HPA023620)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023620-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: VPS9D1
Alternative Gene Name: ATP-BL, C16orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001062: 86%, ENSRNOG00000028904: 85%
Entrez Gene ID: 9605
Uniprot ID: Q9Y2B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IAKAREETLQRKMEERRLRLQEAANRRFCSQVALTPEEREQRALYAAILEYEQDHDWPKHWKAKLKRNPGDLSLVTSLVSHLLSLPDHPIAQLLRRLQCSVYSALYPAVSRAAAPAPGCCPPTPNPGSR |
| Gene Sequence | IAKAREETLQRKMEERRLRLQEAANRRFCSQVALTPEEREQRALYAAILEYEQDHDWPKHWKAKLKRNPGDLSLVTSLVSHLLSLPDHPIAQLLRRLQCSVYSALYPAVSRAAAPAPGCCPPTPNPGSR |
| Gene ID - Mouse | ENSMUSG00000001062 |
| Gene ID - Rat | ENSRNOG00000028904 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS9D1 pAb (ATL-HPA023620) | |
| Datasheet | Anti VPS9D1 pAb (ATL-HPA023620) Datasheet (External Link) |
| Vendor Page | Anti VPS9D1 pAb (ATL-HPA023620) at Atlas Antibodies |
| Documents & Links for Anti VPS9D1 pAb (ATL-HPA023620) | |
| Datasheet | Anti VPS9D1 pAb (ATL-HPA023620) Datasheet (External Link) |
| Vendor Page | Anti VPS9D1 pAb (ATL-HPA023620) |