Anti VPS8 pAb (ATL-HPA036871)

Atlas Antibodies

Catalog No.: ATL-HPA036871-25

Protein Description: vacuolar protein sorting 8 homolog (S. cerevisiae)
Gene Name: VPS8
Alternative Gene Name: FLJ32099, KIAA0804
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033653: 97%, ENSRNOG00000001764: 97%
Entrez Gene ID: 23355
Uniprot ID: Q8N3P4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEIYPYIRTLLHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLARQLA
• Gene Sequence: EEIYPYIRTLLHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLARQLA
• Gene ID - Mouse: ENSMUSG00000033653
• Gene ID - Rat: ENSRNOG00000001764
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VPS8 pAb (ATL-HPA036871) – 2 Found

Hunter, Morag R; Scourfield, Edward J; Emmott, Edward; Graham, Stephen C. VPS18 recruits VPS41 to the human HOPS complex via a RING-RING interaction. The Biochemical Journal. 2017;474(21):3615-3626. 

van der Kant, Rik; Jonker, Caspar T H; Wijdeven, Ruud H; Bakker, Jeroen; Janssen, Lennert; Klumperman, Judith; Neefjes, Jacques. Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity. The Journal Of Biological Chemistry. 2015;290(51):30280-90.