Anti VPS52 pAb (ATL-HPA042667)

Atlas Antibodies

Catalog No.:
ATL-HPA042667-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 52 homolog (S. cerevisiae)
Gene Name: VPS52
Alternative Gene Name: ARE1, SACM2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024319: 100%, ENSRNOG00000000470: 99%
Entrez Gene ID: 6293
Uniprot ID: Q8N1B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAM
Gene Sequence EVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAM
Gene ID - Mouse ENSMUSG00000024319
Gene ID - Rat ENSRNOG00000000470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS52 pAb (ATL-HPA042667)
Datasheet Anti VPS52 pAb (ATL-HPA042667) Datasheet (External Link)
Vendor Page Anti VPS52 pAb (ATL-HPA042667) at Atlas Antibodies

Documents & Links for Anti VPS52 pAb (ATL-HPA042667)
Datasheet Anti VPS52 pAb (ATL-HPA042667) Datasheet (External Link)
Vendor Page Anti VPS52 pAb (ATL-HPA042667)