Anti VPS52 pAb (ATL-HPA042667)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042667-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: VPS52
Alternative Gene Name: ARE1, SACM2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024319: 100%, ENSRNOG00000000470: 99%
Entrez Gene ID: 6293
Uniprot ID: Q8N1B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAM |
| Gene Sequence | EVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAM |
| Gene ID - Mouse | ENSMUSG00000024319 |
| Gene ID - Rat | ENSRNOG00000000470 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS52 pAb (ATL-HPA042667) | |
| Datasheet | Anti VPS52 pAb (ATL-HPA042667) Datasheet (External Link) |
| Vendor Page | Anti VPS52 pAb (ATL-HPA042667) at Atlas Antibodies |
| Documents & Links for Anti VPS52 pAb (ATL-HPA042667) | |
| Datasheet | Anti VPS52 pAb (ATL-HPA042667) Datasheet (External Link) |
| Vendor Page | Anti VPS52 pAb (ATL-HPA042667) |