Anti VPS37D pAb (ATL-HPA040978)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040978-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: VPS37D
Alternative Gene Name: MGC35352, WBSCR24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043614: 95%, ENSRNOG00000048699: 95%
Entrez Gene ID: 155382
Uniprot ID: Q86XT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHC |
| Gene Sequence | LRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHC |
| Gene ID - Mouse | ENSMUSG00000043614 |
| Gene ID - Rat | ENSRNOG00000048699 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS37D pAb (ATL-HPA040978) | |
| Datasheet | Anti VPS37D pAb (ATL-HPA040978) Datasheet (External Link) |
| Vendor Page | Anti VPS37D pAb (ATL-HPA040978) at Atlas Antibodies |
| Documents & Links for Anti VPS37D pAb (ATL-HPA040978) | |
| Datasheet | Anti VPS37D pAb (ATL-HPA040978) Datasheet (External Link) |
| Vendor Page | Anti VPS37D pAb (ATL-HPA040978) |