Anti VPS37D pAb (ATL-HPA040978)

Atlas Antibodies

Catalog No.:
ATL-HPA040978-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 37 homolog D (S. cerevisiae)
Gene Name: VPS37D
Alternative Gene Name: MGC35352, WBSCR24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043614: 95%, ENSRNOG00000048699: 95%
Entrez Gene ID: 155382
Uniprot ID: Q86XT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHC
Gene Sequence LRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHC
Gene ID - Mouse ENSMUSG00000043614
Gene ID - Rat ENSRNOG00000048699
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS37D pAb (ATL-HPA040978)
Datasheet Anti VPS37D pAb (ATL-HPA040978) Datasheet (External Link)
Vendor Page Anti VPS37D pAb (ATL-HPA040978) at Atlas Antibodies

Documents & Links for Anti VPS37D pAb (ATL-HPA040978)
Datasheet Anti VPS37D pAb (ATL-HPA040978) Datasheet (External Link)
Vendor Page Anti VPS37D pAb (ATL-HPA040978)