Anti VPS37C pAb (ATL-HPA043348)

Atlas Antibodies

Catalog No.: ATL-HPA043348-25

Protein Description: vacuolar protein sorting 37 homolog C (S. cerevisiae)
Gene Name: VPS37C
Alternative Gene Name: FLJ20847
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048832: 88%, ENSRNOG00000046439: 88%
Entrez Gene ID: 55048
Uniprot ID: A5D8V6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIEEESEAMAEKFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGD
• Gene Sequence: KIEEESEAMAEKFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGD
• Gene ID - Mouse: ENSMUSG00000048832
• Gene ID - Rat: ENSRNOG00000046439
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.