Anti VPS36 pAb (ATL-HPA039734)

Atlas Antibodies

Catalog No.: ATL-HPA039734-25

Protein Description: vacuolar protein sorting 36 homolog (S. cerevisiae)
Gene Name: VPS36
Alternative Gene Name: C13orf9, CGI-145, Eap45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031479: 93%, ENSRNOG00000012654: 94%
Entrez Gene ID: 51028
Uniprot ID: Q86VN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG
• Gene Sequence: AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG
• Gene ID - Mouse: ENSMUSG00000031479
• Gene ID - Rat: ENSRNOG00000012654
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.