Anti VPS33B pAb (ATL-HPA040415)

Atlas Antibodies

Catalog No.: ATL-HPA040415-25

Protein Description: vacuolar protein sorting 33 homolog B (yeast)
Gene Name: VPS33B
Alternative Gene Name: FLJ14848
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030534: 99%, ENSRNOG00000013149: 99%
Entrez Gene ID: 26276
Uniprot ID: Q9H267
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQE
• Gene Sequence: KSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQE
• Gene ID - Mouse: ENSMUSG00000030534
• Gene ID - Rat: ENSRNOG00000013149
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.