Anti VPS26B pAb (ATL-HPA038172)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038172-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: VPS26B
Alternative Gene Name: MGC10485, Pep8b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031988: 96%, ENSRNOG00000047235: 96%
Entrez Gene ID: 112936
Uniprot ID: Q4G0F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ |
| Gene Sequence | RRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ |
| Gene ID - Mouse | ENSMUSG00000031988 |
| Gene ID - Rat | ENSRNOG00000047235 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS26B pAb (ATL-HPA038172) | |
| Datasheet | Anti VPS26B pAb (ATL-HPA038172) Datasheet (External Link) |
| Vendor Page | Anti VPS26B pAb (ATL-HPA038172) at Atlas Antibodies |
| Documents & Links for Anti VPS26B pAb (ATL-HPA038172) | |
| Datasheet | Anti VPS26B pAb (ATL-HPA038172) Datasheet (External Link) |
| Vendor Page | Anti VPS26B pAb (ATL-HPA038172) |