Anti VPS26B pAb (ATL-HPA038172)

Atlas Antibodies

Catalog No.: ATL-HPA038172-25

Protein Description: vacuolar protein sorting 26 homolog B (S. pombe)
Gene Name: VPS26B
Alternative Gene Name: MGC10485, Pep8b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031988: 96%, ENSRNOG00000047235: 96%
Entrez Gene ID: 112936
Uniprot ID: Q4G0F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ
• Gene Sequence: RRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ
• Gene ID - Mouse: ENSMUSG00000031988
• Gene ID - Rat: ENSRNOG00000047235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.