Anti VN1R4 pAb (ATL-HPA027018)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027018-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: VN1R4
Alternative Gene Name: V1RL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059206: 43%, ENSRNOG00000054281: 43%
Entrez Gene ID: 317703
Uniprot ID: Q7Z5H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLL |
| Gene Sequence | TGKWNYTNITVNEDLGYCSGGGNNKIAQTLRAMLL |
| Gene ID - Mouse | ENSMUSG00000059206 |
| Gene ID - Rat | ENSRNOG00000054281 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VN1R4 pAb (ATL-HPA027018) | |
| Datasheet | Anti VN1R4 pAb (ATL-HPA027018) Datasheet (External Link) |
| Vendor Page | Anti VN1R4 pAb (ATL-HPA027018) at Atlas Antibodies |
| Documents & Links for Anti VN1R4 pAb (ATL-HPA027018) | |
| Datasheet | Anti VN1R4 pAb (ATL-HPA027018) Datasheet (External Link) |
| Vendor Page | Anti VN1R4 pAb (ATL-HPA027018) |