Anti VN1R2 pAb (ATL-HPA044551)

Atlas Antibodies

Catalog No.:
ATL-HPA044551-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: vomeronasal 1 receptor 2
Gene Name: VN1R2
Alternative Gene Name: V1RL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059206: 46%, ENSRNOG00000055538: 43%
Entrez Gene ID: 317701
Uniprot ID: Q8NFZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTS
Gene Sequence TTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTS
Gene ID - Mouse ENSMUSG00000059206
Gene ID - Rat ENSRNOG00000055538
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VN1R2 pAb (ATL-HPA044551)
Datasheet Anti VN1R2 pAb (ATL-HPA044551) Datasheet (External Link)
Vendor Page Anti VN1R2 pAb (ATL-HPA044551) at Atlas Antibodies

Documents & Links for Anti VN1R2 pAb (ATL-HPA044551)
Datasheet Anti VN1R2 pAb (ATL-HPA044551) Datasheet (External Link)
Vendor Page Anti VN1R2 pAb (ATL-HPA044551)