Anti VAV2 pAb (ATL-HPA003224)

Atlas Antibodies

Catalog No.:
ATL-HPA003224-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: vav 2 guanine nucleotide exchange factor
Gene Name: VAV2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009621: 96%, ENSRNOG00000007422: 96%
Entrez Gene ID: 7410
Uniprot ID: P52735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWI
Gene Sequence PVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWI
Gene ID - Mouse ENSMUSG00000009621
Gene ID - Rat ENSRNOG00000007422
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VAV2 pAb (ATL-HPA003224)
Datasheet Anti VAV2 pAb (ATL-HPA003224) Datasheet (External Link)
Vendor Page Anti VAV2 pAb (ATL-HPA003224) at Atlas Antibodies

Documents & Links for Anti VAV2 pAb (ATL-HPA003224)
Datasheet Anti VAV2 pAb (ATL-HPA003224) Datasheet (External Link)
Vendor Page Anti VAV2 pAb (ATL-HPA003224)