Anti VAMP5 pAb (ATL-HPA035082)

Atlas Antibodies

Catalog No.:
ATL-HPA035082-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: vesicle-associated membrane protein 5
Gene Name: VAMP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102671: 77%, ENSRNOG00000012659: 76%
Entrez Gene ID: 10791
Uniprot ID: O95183
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
Gene Sequence MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
Gene ID - Mouse ENSMUSG00000102671
Gene ID - Rat ENSRNOG00000012659
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VAMP5 pAb (ATL-HPA035082)
Datasheet Anti VAMP5 pAb (ATL-HPA035082) Datasheet (External Link)
Vendor Page Anti VAMP5 pAb (ATL-HPA035082) at Atlas Antibodies

Documents & Links for Anti VAMP5 pAb (ATL-HPA035082)
Datasheet Anti VAMP5 pAb (ATL-HPA035082) Datasheet (External Link)
Vendor Page Anti VAMP5 pAb (ATL-HPA035082)