Anti UTP4 pAb (ATL-HPA043542)

Atlas Antibodies

Catalog No.: ATL-HPA043542-25

Protein Description: UTP4, small subunit processome component
Gene Name: UTP4
Alternative Gene Name: CIRH1A, CIRHIN, FLJ14728, KIAA1988, NAIC, TEX292
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041438: 96%, ENSRNOG00000020333: 98%
Entrez Gene ID: 84916
Uniprot ID: Q969X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQ
• Gene Sequence: RVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQ
• Gene ID - Mouse: ENSMUSG00000041438
• Gene ID - Rat: ENSRNOG00000020333
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.