Anti UTP4 pAb (ATL-HPA043542)

Atlas Antibodies

Catalog No.:
ATL-HPA043542-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UTP4, small subunit processome component
Gene Name: UTP4
Alternative Gene Name: CIRH1A, CIRHIN, FLJ14728, KIAA1988, NAIC, TEX292
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041438: 96%, ENSRNOG00000020333: 98%
Entrez Gene ID: 84916
Uniprot ID: Q969X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQ
Gene Sequence RVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQ
Gene ID - Mouse ENSMUSG00000041438
Gene ID - Rat ENSRNOG00000020333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UTP4 pAb (ATL-HPA043542)
Datasheet Anti UTP4 pAb (ATL-HPA043542) Datasheet (External Link)
Vendor Page Anti UTP4 pAb (ATL-HPA043542) at Atlas Antibodies

Documents & Links for Anti UTP4 pAb (ATL-HPA043542)
Datasheet Anti UTP4 pAb (ATL-HPA043542) Datasheet (External Link)
Vendor Page Anti UTP4 pAb (ATL-HPA043542)