Anti UTP3 pAb (ATL-HPA035655)

Atlas Antibodies

Catalog No.: ATL-HPA035655-25

Protein Description: UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Gene Name: UTP3
Alternative Gene Name: CRLZ1, DKFZp761F222, FLJ23256, SAS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070697: 90%, ENSRNOG00000003599: 95%
Entrez Gene ID: 57050
Uniprot ID: Q9NQZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ
• Gene Sequence: LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ
• Gene ID - Mouse: ENSMUSG00000070697
• Gene ID - Rat: ENSRNOG00000003599
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UTP3 pAb (ATL-HPA035655) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.