Anti UST pAb (ATL-HPA032022)

Atlas Antibodies

Catalog No.:
ATL-HPA032022-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: uronyl-2-sulfotransferase
Gene Name: UST
Alternative Gene Name: 2OST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047712: 100%, ENSRNOG00000016381: 96%
Entrez Gene ID: 10090
Uniprot ID: Q9Y2C2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFG
Gene Sequence YNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFG
Gene ID - Mouse ENSMUSG00000047712
Gene ID - Rat ENSRNOG00000016381
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UST pAb (ATL-HPA032022)
Datasheet Anti UST pAb (ATL-HPA032022) Datasheet (External Link)
Vendor Page Anti UST pAb (ATL-HPA032022) at Atlas Antibodies

Documents & Links for Anti UST pAb (ATL-HPA032022)
Datasheet Anti UST pAb (ATL-HPA032022) Datasheet (External Link)
Vendor Page Anti UST pAb (ATL-HPA032022)