Anti USPL1 pAb (ATL-HPA040172)

Atlas Antibodies

Catalog No.:
ATL-HPA040172-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase like 1
Gene Name: USPL1
Alternative Gene Name: bA121O19.1, C13orf22, D13S106E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041264: 57%, ENSRNOG00000000909: 58%
Entrez Gene ID: 10208
Uniprot ID: Q5W0Q7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SIEDLLNELPYPIDIASESACTTVPGVSLYSSQTHEEILAELLSPTPVSTELSENGEGDFRYLGMGDSHSPPPVPSEFNDVSQNTHLRQDHNYCSPTKKNPCEVQPDS
Gene Sequence SIEDLLNELPYPIDIASESACTTVPGVSLYSSQTHEEILAELLSPTPVSTELSENGEGDFRYLGMGDSHSPPPVPSEFNDVSQNTHLRQDHNYCSPTKKNPCEVQPDS
Gene ID - Mouse ENSMUSG00000041264
Gene ID - Rat ENSRNOG00000000909
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USPL1 pAb (ATL-HPA040172)
Datasheet Anti USPL1 pAb (ATL-HPA040172) Datasheet (External Link)
Vendor Page Anti USPL1 pAb (ATL-HPA040172) at Atlas Antibodies

Documents & Links for Anti USPL1 pAb (ATL-HPA040172)
Datasheet Anti USPL1 pAb (ATL-HPA040172) Datasheet (External Link)
Vendor Page Anti USPL1 pAb (ATL-HPA040172)