Anti USP7 pAb (ATL-HPA015641)

Atlas Antibodies

Catalog No.: ATL-HPA015641-25

Protein Description: ubiquitin specific peptidase 7 (herpes virus-associated)
Gene Name: USP7
Alternative Gene Name: HAUSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022710: 99%, ENSRNOG00000025496: 99%
Entrez Gene ID: 7874
Uniprot ID: Q93009
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSK
• Gene Sequence: RSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWDSK
• Gene ID - Mouse: ENSMUSG00000022710
• Gene ID - Rat: ENSRNOG00000025496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.