Anti USP50 pAb (ATL-HPA039470)

Atlas Antibodies

Catalog No.:
ATL-HPA039470-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 50
Gene Name: USP50
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027364: 69%, ENSRNOG00000011401: 69%
Entrez Gene ID: 373509
Uniprot ID: Q70EL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCF
Gene Sequence YHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCF
Gene ID - Mouse ENSMUSG00000027364
Gene ID - Rat ENSRNOG00000011401
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP50 pAb (ATL-HPA039470)
Datasheet Anti USP50 pAb (ATL-HPA039470) Datasheet (External Link)
Vendor Page Anti USP50 pAb (ATL-HPA039470) at Atlas Antibodies

Documents & Links for Anti USP50 pAb (ATL-HPA039470)
Datasheet Anti USP50 pAb (ATL-HPA039470) Datasheet (External Link)
Vendor Page Anti USP50 pAb (ATL-HPA039470)