Anti USP46 pAb (ATL-HPA007288)

Atlas Antibodies

Catalog No.: ATL-HPA007288-25

Protein Description: ubiquitin specific peptidase 46
Gene Name: USP46
Alternative Gene Name: FLJ12552
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054814: 100%, ENSRNOG00000002106: 99%
Entrez Gene ID: 64854
Uniprot ID: P62068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN
• Gene Sequence: LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN
• Gene ID - Mouse: ENSMUSG00000054814
• Gene ID - Rat: ENSRNOG00000002106
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP46 pAb (ATL-HPA007288) – 2 Found

Ohashi, Makoto; Holthaus, Amy M; Calderwood, Michael A; Lai, Chiou-Yan; Krastins, Bryan; Sarracino, David; Johannsen, Eric. The EBNA3 family of Epstein-Barr virus nuclear proteins associates with the USP46/USP12 deubiquitination complexes to regulate lymphoblastoid cell line growth. Plos Pathogens. 2015;11(4):e1004822. 

Kiran, Shashi; Dar, Ashraf; Singh, Samarendra K; Lee, Kyung Yong; Dutta, Anindya. The Deubiquitinase USP46 Is Essential for Proliferation and Tumor Growth of HPV-Transformed Cancers. Molecular Cell. 2018;72(5):823-835.e5.