Anti USP36 pAb (ATL-HPA012082)

Atlas Antibodies

Catalog No.: ATL-HPA012082-25

Protein Description: ubiquitin specific peptidase 36
Gene Name: USP36
Alternative Gene Name: FLJ12851, KIAA1453
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033909: 73%, ENSRNOG00000028255: 72%
Entrez Gene ID: 57602
Uniprot ID: Q9P275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPP
• Gene Sequence: DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPP
• Gene ID - Mouse: ENSMUSG00000033909
• Gene ID - Rat: ENSRNOG00000028255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP36 pAb (ATL-HPA012082) – 1 Found

van den Heuvel, Jasmin; Ashiono, Caroline; Gillet, Ludovic C; Dörner, Kerstin; Wyler, Emanuel; Zemp, Ivo; Kutay, Ulrike. Processing of the ribosomal ubiquitin-like fusion protein FUBI-eS30/FAU is required for 40S maturation and depends on USP36. Elife. 2021;10( 34318747)