Anti USP30 pAb (ATL-HPA016952 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA016952-25

Protein Description: ubiquitin specific peptidase 30
Gene Name: USP30
Alternative Gene Name: FLJ40511, MGC10702
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029592: 83%, ENSRNOG00000028556: 81%
Entrez Gene ID: 84749
Uniprot ID: Q70CQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
• Gene Sequence: IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST
• Gene ID - Mouse: ENSMUSG00000029592
• Gene ID - Rat: ENSRNOG00000028556
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP30 pAb (ATL-HPA016952 w/enhanced validation) – 6 Found

Gersch, Malte; Gladkova, Christina; Schubert, Alexander F; Michel, Martin A; Maslen, Sarah; Komander, David. Mechanism and regulation of the Lys6-selective deubiquitinase USP30. Nature Structural & Molecular Biology. 2017;24(11):920-930. 

Marcassa, Elena; Kallinos, Andreas; Jardine, Jane; Rusilowicz-Jones, Emma V; Martinez, Aitor; Kuehl, Sandra; Islinger, Markus; Clague, Michael J; Urbé, Sylvie. Dual role of USP30 in controlling basal pexophagy and mitophagy. Embo Reports. 2018;19(7) 

Tsefou, Eliona; Walker, Alison S; Clark, Emily H; Hicks, Amy R; Luft, Christin; Takeda, Kunitoshi; Watanabe, Toru; Ramazio, Bianca; Staddon, James M; Briston, Thomas; Ketteler, Robin. Investigation of USP30 inhibition to enhance Parkin-mediated mitophagy: tools and approaches. The Biochemical Journal. 2021;478(23):4099-4118. 

Rusilowicz-Jones, Emma V; Barone, Francesco G; Lopes, Fernanda Martins; Stephen, Elezabeth; Mortiboys, Heather; Urbé, Sylvie; Clague, Michael J. Benchmarking a highly selective USP30 inhibitor for enhancement of mitophagy and pexophagy. Life Science Alliance. 2022;5(2) 

Bingol, Baris; Tea, Joy S; Phu, Lilian; Reichelt, Mike; Bakalarski, Corey E; Song, Qinghua; Foreman, Oded; Kirkpatrick, Donald S; Sheng, Morgan. The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy. Nature. 2014;510(7505):370-5. 

Rusilowicz-Jones, Emma V; Jardine, Jane; Kallinos, Andreas; Pinto-Fernandez, Adan; Guenther, Franziska; Giurrandino, Mariacarmela; Barone, Francesco G; McCarron, Katy; Burke, Christopher J; Murad, Alejandro; Martinez, Aitor; Marcassa, Elena; Gersch, Malte; Buckmelter, Alexandre J; Kayser-Bricker, Katherine J; Lamoliatte, Frederic; Gajbhiye, Akshada; Davis, Simon; Scott, Hannah C; Murphy, Emma; England, Katherine; Mortiboys, Heather; Komander, David; Trost, Matthias; Kessler, Benedikt M; Ioannidis, Stephanos; Ahlijanian, Michael K; Urbé, Sylvie; Clague, Michael J. USP30 sets a trigger threshold for PINK1-PARKIN amplification of mitochondrial ubiquitylation. Life Science Alliance. 2020;3(8)