Anti USP24 pAb (ATL-HPA026723)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026723-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: USP24
Alternative Gene Name: KIAA1057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028514: 97%, ENSRNOG00000005802: 97%
Entrez Gene ID: 23358
Uniprot ID: Q9UPU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVADFIIDILLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQ |
| Gene Sequence | AGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVADFIIDILLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQ |
| Gene ID - Mouse | ENSMUSG00000028514 |
| Gene ID - Rat | ENSRNOG00000005802 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti USP24 pAb (ATL-HPA026723) | |
| Datasheet | Anti USP24 pAb (ATL-HPA026723) Datasheet (External Link) |
| Vendor Page | Anti USP24 pAb (ATL-HPA026723) at Atlas Antibodies |
| Documents & Links for Anti USP24 pAb (ATL-HPA026723) | |
| Datasheet | Anti USP24 pAb (ATL-HPA026723) Datasheet (External Link) |
| Vendor Page | Anti USP24 pAb (ATL-HPA026723) |