Anti USP2 pAb (ATL-HPA007222)

Atlas Antibodies

Catalog No.: ATL-HPA007222-25

Protein Description: ubiquitin specific peptidase 2
Gene Name: USP2
Alternative Gene Name: UBP41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032010: 74%, ENSRNOG00000006663: 77%
Entrez Gene ID: 9099
Uniprot ID: O75604
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYR
• Gene Sequence: SGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYR
• Gene ID - Mouse: ENSMUSG00000032010
• Gene ID - Rat: ENSRNOG00000006663
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.