Anti USP13 pAb (ATL-HPA004827)

Atlas Antibodies

Catalog No.: ATL-HPA004827-25

Protein Description: ubiquitin specific peptidase 13 (isopeptidase T-3)
Gene Name: USP13
Alternative Gene Name: IsoT-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056900: 92%, ENSRNOG00000030639: 90%
Entrez Gene ID: 8975
Uniprot ID: Q92995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISH
• Gene Sequence: RKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEMENNANANIISEAKPEGPRVKDGSGTYELFAFISH
• Gene ID - Mouse: ENSMUSG00000056900
• Gene ID - Rat: ENSRNOG00000030639
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP13 pAb (ATL-HPA004827) – 1 Found

Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.